PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009144991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 314aa    MW: 37089.3 Da    PI: 6.4312
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009144991.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.13.7e-081155240
        zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    ++r C+++ +k++ ++C +++ +lC+ C ++ H+       H++v
  XP_009144991.1 11 RPRDCELCLNKHAVWYCASDDAFLCHVCDESVHRAnqvatkHDRV 55
                    5788*****************************767888888765 PP

2CCT682.6e-23266309144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++ RY++Krk+R+FeKkirYe+RK++A++RpR+KGrFv+++
  XP_009144991.1 266 REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRIKGRFVRRS 309
                     9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.2E-71057IPR000315B-box-type zinc finger
PROSITE profilePS5011910.0251057IPR000315B-box-type zinc finger
PfamPF006431.1E-61255IPR000315B-box-type zinc finger
CDDcd000218.83E-91557No hitNo description
PROSITE profilePS5101716.053266308IPR010402CCT domain
PfamPF062036.9E-18266308IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MIPERQEDVK RPRDCELCLN KHAVWYCASD DAFLCHVCDE SVHRANQVAT KHDRVCLKTN  60
EISNGVLQGT ARKPVWHSWF RRKPRTPRVR CERKPQGKVD DERRREGPHV PEIGGETNEE  120
DENLTSLVPE FQGFIEMEFF LNNHDGSEET MRQFNVDHET DEMEDLCYIE EEGKTNGDEA  180
CHEQSLTSCK NEYDINPTLV TTKTEENAKQ RNLLLRLNYE NVIAAWDKQE SPTTATWNQN  240
EFSNTSNFQL VPPGIEEEKV SNRSEREARV WRYRDKRKNR LFEKKIRYEV RKVNADKRPR  300
IKGRFVRRSL TNDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144991.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 8
SwissprotQ9M9B31e-151COL8_ARATH; Zinc finger protein CONSTANS-LIKE 8
TrEMBLA0A078JLI50.0A0A078JLI5_BRANA; BnaA05g36570D protein
TrEMBLM4ETZ10.0M4ETZ1_BRARP; Uncharacterized protein
STRINGBra032273.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150481517
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49130.11e-152B-box type zinc finger protein with CCT domain